Recombinant Meleagrid herpesvirus 1 Envelope protein UL45 homolog

Code CSB-CF323024MDM
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P18536
Storage Buffer Tris-based buffer,50% glycerol
Species Meleagrid herpesvirus 1 (strain H2) (MeHV-1) (Turkey herpesvirus)
Sequence MMSPTPEDDRDLVVVRGRLRMMDSGTETDREQRHPRTTWRSICCGCTIGMVFTIFVLVAA VLLGSLFTVSYMAMESGTCPDEWIGLGYSCMRVAGKNATDLEALDTCARHNSKLIDFANA KVLVEAIAPFGVPNAAYGEVFRLRDSKTTCIRPTMGGPVSADCPVTCTVICQRPRPLSTM SSIIRDARVYLHLERRDYYEVYASVLSNAMSK
Source in vitro E.coli expression system
Protein Names Recommended name: Envelope protein UL45 homolog Alternative name(s): 23.5 kDa protein
Expression Region 1-212
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Virion membrane, Single-pass type II membrane protein
Protein Families Herpesviridae HHV-1 UL45 family

Related Products

Proteins

Proteins for Meleagrid herpesvirus 1 (strain H2) (MeHV-1) (Turkey herpesvirus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.