Recombinant Mouse Alpha-2,8-sialyltransferase 8B(St8sia2)

Code CSB-CF022775MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O35696
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT
Source in vitro E.coli expression system
Gene Names St8sia2
Protein Names Recommended name: Alpha-2,8-sialyltransferase 8B EC= 2.4.99.- Alternative name(s): Polysialic acid synthase Sialyltransferase 8B Short name= SIAT8-B Sialyltransferase X Short name= STX Sialytransferase St8Sia II Short name= ST8SiaII
Expression Region 1-375
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May transfer sialic acid through alpha-2,8-linkages to the alpha-2,3-linked and alpha-2,6-linked sialic acid of N-linked oligosaccharides of glycoproteins and may be involved in PSA (polysialic acid) expression.
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 29 family
Database Links

KEGG: mmu:20450

STRING: 10090.ENSMUSP00000026896

UniGene: Mm.4954

Related Products

St8sia2 Proteins

St8sia2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.