Recombinant Mouse CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase(St3gal3)

Code CSB-CF022753MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P97325
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLLLSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Source in vitro E.coli expression system
Gene Names St3gal3
Protein Names Recommended name: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase EC= 2.4.99.6 Alternative name(s): Beta-galactoside alpha-2,3-sialyltransferase 3 Short name= Alpha 2,3-ST 3 Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltrans
Expression Region 1-374
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.
Subcellular Location Membrane, Single-pass type II membrane protein, Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 29 family
Tissue Specificity Found in all tissues tested. High expression found in brain, liver, kidney, colon, heart and spleen.
Database Links

KEGG: mmu:20441

STRING: 10090.ENSMUSP00000030263

UniGene: Mm.251002

Related Products

St3gal3 Proteins

St3gal3 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.