Product Details

Target Names

Cers2

Uniprot No.

Alternative Names

Cers2; Lass2; Trh3; Ceramide synthase 2; CerS2; LAG1 longevity assurance homolog 2; Sphingosine N-acyltransferase CERS2; Translocating chain-associating membrane protein homolog 3; TRAM homolog 3; Tumor metastasis-suppressor gene 1 protein; Very-long-chain ceramide synthase CERS2

Species

Mus musculus (Mouse)

Expression Region

1-380

Target Protein Sequence

MLQTLYDYFWWERLWLPVNLTWADLEDKDGRVYAKASDLYITLPLALLFLVIRYFFELYV ATPLAALLNVKEKTRLRAPPNATLEHFYQTSGKQPKQVEVDLLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTYYLIAFVAGMAVTVDKPWFYDLRKVWEGYPIQSIIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILLCFSWFANYVRAGTLIMALHD ASDYLLESAKMFNYAGWKNTCNNLFIVFAIVFIITRLVIMPFWILHCTMIYPLELYPAFF GYYFFNFMMAVLQMLHIFWAYFILRMAHKFITGKLIEDERSDREETESSEGEETAAGAGA KSRLLANGHPILNNNHPKND

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward very-long-chain fatty acyl-CoA (chain length C22-C27). N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides in de novo synthesis and salvage pathways, respectively. Plays a non-redundant role in the synthesis of ceramides with very-long-chain fatty acids in kidney, liver and brain. Regulates the abundance of myelin-specific sphingolipids galactosylceramide and sulfatide that affects myelin sheath architecture and motor neuron functions.

Gene References into Functions

Gene expression analyses in livers of transgenic mouse mutants revealed that inactivation of CerS2 catalytic activity largely affects transcription of genes involved in lipid metabolism and cell division and is associated with the formation of hepatocellular carcinoma in 6 to 8-week-old mice. PMID: 29653252
Deficiency of CerS2 influences intestinal barrier function and the severity of experimental colitis and may represent a potential mechanism for inflammatory bowel disease pathogenesis. PMID: 28699686
LASS2 plays an important role in efficient liver regeneration in response to partial hepatectomy. PMID: 28958935
Deletion of CerS2 strongly reduced very long-chain ceramides (Cer24:0, 24:1) but concomitantly increased long-chain ceramides and sphinganine in plasma and colon tissue. In naive CerS2(-/-) mice, the expression of tight junction proteins including ZO-1 was almost completely lost in the colon epithelium, leading to increased membrane permeability. Ceramide synthase 2 deficiency aggravates dextran induced colitis in mice. PMID: 28405720
this study shows that Cers2 limits the levels of S1P in thymus and blood to maintain functional S1P gradients that mediate thymocyte emigration into the circulation PMID: 28198542
that only LCBs, the substrates common for all of the CerS isoforms, but not ceramides and complex sphingolipids, were restored to the wild-type levels in the Cers2-rescued Cers1 mutant mouse brains. PMID: 27162368
CerS1, -2, and -6 are hyperacetylated in the mitochondria of SIRT3-null mice. PMID: 26620563
Haploinsufficiency for this enzyme altered the pattern of ceramide acylation in the liver without affecting total ceramide levels, replacing very-long-chain ceramides with long-chain C16-ceramides. PMID: 25295789
Development of pheochromocytoma in ceramide synthase 2 null mice PMID: 26113602
our data strongly indicate that G-CSF-induced CXCR2 expression is regulated in a CerS2-dependent manner and that CerS2 thereby promotes the migration of neutrophils, thus, contributing to inflammation and the development of EAE and MS. PMID: 25697397
study is the first comparison of spatial distribution between SM molecular species and CerS isoforms, and revealed their distinct association in the brain. PMID: 26398595
Data indicate that the augmented rate of death of ceramide synthase 2 (CerS2) null mice is due to elevated levels of tumor necrosis factor alpha (TNFalpha) secretion as a result of enhanced activity of TNFalpha-converting enzyme (TACE). PMID: 26183206
CerS2-deficient kidneys were completely depleted of phytosphingosine-containing cortical sulfatides without any compensatio PMID: 25267995
we first report that Lass2 deficiency caused the downregulation of miR-694 and the upregulation of its target gene Tnfaip3 in vivo in mice, which may be related to a high risk of occurrence of hepatocellular carcinoma PMID: 25333455
The identification of specific cell types in which CerS2 protein is expressed is prerequisite to further mechanistic characterization of phenotypic abnormalities exhibited by CerS2-deficient mice. PMID: 23591958
Lass2 is a protective gene against diethylnitrosamine-induced liver tumorigenesis; and upregulation of the TGF-beta1-Smad4-PAI-1 axis may contribute to the vulnerability of Lass2-knockout mice to diethylnitrosamine. PMID: 24337404
Protection of a ceramide synthase 2 null mouse from drug-induced liver injury: role of gap junction dysfunction and connexin 32 mislocalization. PMID: 24019516
expression and role of ceramide synthase-2 in the lung PMID: 23690971
Ablation of ceramide synthase 2 causes chronic oxidative stress due to disruption of the mitochondrial respiratory chain PMID: 23283968
Loss of ceramide synthase 2 alters lipid metabolic pathways by inhibiting very long acyl chain ceramide synthesis. PMID: 20110363
Loss of CerS2 is associated with hepatocellular carcinoma and hepatomegaly. PMID: 20110366
Results indicate that CERS2 activity supports different biological functions: maintenance of myelin, stabilization of the cerebellar as well as renal histological architecture, and protection against hepatocarcinomas. PMID: 19801672
activity of CerS2 can be regulated by another bioactive sphingolipid, sphingosine 1-phosphate PMID: 18165233

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Tissue Specificity

Broadly expressed, with highest levels in liver and kidney. In brain is detected in neurons, oligodentrocytes, ependymal cells and epithelial cells of the choroid plexus. In kidney is detected in collecting ducts and to a lesser degree in proximal tubules

Database Links

KEGG: mmu:76893

STRING: 10090.ENSMUSP00000015858

UniGene: Mm.181009

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF852880MO
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Ceramide synthase 2 (Cers2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage