Recombinant Mouse Gap junction beta-6 protein (Gjb6)

Code CSB-CF009456MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Gjb6
Uniprot No.
Alternative Names
Gjb6; Cxn-30; Gap junction beta-6 protein; Connexin-30; Cx30
Species
Mus musculus (Mouse)
Expression Region
1-261
Target Protein Sequence
MDWGTLHTVIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGC KNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETARKFIRGEKRNEFKDLED IKRQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDC FISRPTEKTVFTVFMISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESK QNEMNELISDSGQNAITSFPS
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
  1. Data show that the passive compliance of the cochlear partition and active frequency tuning of the basilar membrane are enhanced in the cochleae of CD-1onnexin-30 (Cx30)(A88V/A88V) compared to CBA/J mice with sensitive high-frequency hearing. PMID: 28220769
  2. Results demonstrate that Cx43, but not Cx30, is crucial for adult neurogenesis in the hippocampus. PMID: 28689039
  3. connexin 30 controls astroglial polarity during development PMID: 29475972
  4. In Cx30 and Cx26 knock-out animals, inner hair cells remained stuck at a prehearing stage of development. PMID: 28077706
  5. Connexin 30, but not connexin 43, hemichannels close upon protein kinase C activation, illustrating that connexin hemichannels display not only isoform-specific permeability profiles but also isoform-specific regulation by protein kinase C. PMID: 26400258
  6. four unique Cx30 mutants might cause disease through different mechanisms that also likely include their selective trans-dominant effects on coexpressed connexins. PMID: 24522190
  7. The cortex modafinil injection increases the expression of mRNA and protein of connexin 30. PMID: 23665355
  8. The Cx30A88V mutation triggers hyperproliferation in the skin and changes the cochlear homeostasis in mice. PMID: 24685692
  9. Connexin30 is expressed at significantly higher levels in the buccal mucosa than the epidermis and, unlike in skin, it is rapidly down-regulated at the wound edge within 6 hours of wounding. This may underlie the rapid healing of the buccal mucosa. PMID: 23627777
  10. The observations demonstrate a role for Cx30 and intercellular communication in regulating repair responses in an epithelial tissue. PMID: 23424196
  11. We showed co-expression of Cx30 and p63 in developing mouse hair follicles and nail units. PMID: 23219093
  12. in the Cx30 knock-out mouse model, defective Cx26 expression is the likely cause of deafness, and in contrast to current opinion, Cx30 is dispensable for cochlear functions PMID: 23303923
  13. This study demonistrated that Cx30/Cx47 double-deficient mice has the functional role of both connexins for interastrocytic, interoligodendrocytic, and panglial coupling, and show that both connexins are required for maintenance of myelin. PMID: 22649229
  14. Loss of Cx30 and the white matter pathology observed does not affect expression of experimental autoimmune encephalitis; astrocyte gap junctions do not regulate autoimmune inflammation. PMID: 22342190
  15. This study suggested that cx30 defiency affect expression levels of glial glutamate transporters within the cerebrum. PMID: 22037505
  16. Employing tracer coupling analyses in acute slices of Cx30 deficient mice demonstrate that Cx30 makes a substantial contribution to interastrocytic gap junctional communication in the mouse hippocampus. PMID: 21264956
  17. These results of this study suggested that alterations of astrocyte connexins might be involved in the suicide process and provide further evidence implicating astrocytes in psychopathology. PMID: 21571253
  18. loss of the ability of ENaC to respond to changes in sodium levels contributes to salt-sensitive hypertension in Cx30(-/-) mice PMID: 21075848
  19. Cx30 is functionally expressed, in low abundance, in the SA node of the adult mouse heart where it participates in heart rate regulation. PMID: 19679680
  20. Cx30 (Gjb6) deficient mice exhibit a severe constitutive hearing impairment.The Cx30 deficient mice may represent a valuable model to study the mechanism of the hearing loss in human patients carrying a homozygous deletion of the CX30 gene . PMID: 12490528
  21. Elimination of connexin30 can alter reactivity to novel environments. Importance of gap-junctional signalling in behavioural processes. PMID: 12911759
  22. Cx30 is abundant in late-pregnant and early lactating gland epithelium. PMID: 17120054
  23. In the absence of the Cx30 gene, Cx26 expressed from extra alleles completely restored hearing sensitivity and prevented hair cell death in deaf Cx30-/- mice PMID: 17227867
  24. Connexin30 deficiency causes instrastrial fluid-blood barrier disruption within the cochlear stria vascularis. PMID: 17400755
  25. Cx30 immunoreactivity was found extensively in vestibular supporting cells and connective tissue cells. PMID: 17702002
  26. Expression of Cx30 and Cx43 a is upregulated in cortical astrocytes cocultured with neurons. PMID: 18512249
  27. effects of Cx30 null mutation on GJ-mediated ionic and metabolic coupling in the cochlea of mice PMID: 19116647
  28. Mechanosensitive Cx30 hemichannels have an integral role in pressure natriuresis by releasing ATP into the tubular fluid, which inhibits salt and water reabsorption. PMID: 19478095

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Beta-type (group I) subfamily
Tissue Specificity
Highly expressed in adult brain and skin. Less in uterus, lung and eye. Very low in testis and sciatic nerve. No expression before birth.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1