Recombinant Mouse Keratinocyte-associated protein 3(Krtcap3)

Code CSB-CF810364MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8K177
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MRCCGVCAFDAARGPRRLMRVGLALILVGHVNLLVGAVLHGTVLRHVANPRGAVTPEYTT ANVISVGSGLLSVSVGLVALLASRNLLRPRLHWALLTLALVNLLLSAACSMGLLLAVSLT VANGGRRLIADCHPGLMDPSIPLDQGPGHTDCSFDPTRIYDTALALWIPSLFMSAAEAAL SGYCCVAALTLRGIGPCRKEGLQEQLQELTELELPECKRQENVQLLHGRQDFQALQKTWV
Source in vitro E.coli expression system
Gene Names Krtcap3
Protein Names Recommended name: Keratinocyte-associated protein 3 Short name= KCP-3
Expression Region 1-240
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TMEM54 family
Database Links

KEGG: mmu:69815

STRING: 10090.ENSMUSP00000060414

UniGene: Mm.389609

Related Products

Krtcap3 Proteins

Krtcap3 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.