Recombinant Mouse Membrane progestin receptor alpha(Paqr7)

Code CSB-CF767364MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q80ZE4
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MAMAVAQKFNHLLSSLWHVGQKPPQPEPVFTVDRAQVPPLFWKPYIYAGYRPLHQNWCFY FRTLFQRHNEAVNVWTHLLAALALLLRLIGLAASVDFREDPHALPLFFIVLASFTYLSFS AVAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPSWHDKVQAIFLPTAAFL AWLSCAGSCYNKYSQKPGLLGRIFQEAPSALAYVLDISPVLHRIIVSPLPAEEDPALLYH KCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQGHQVFHVFLVLCTLAQLEAVTLDYQARR GIYEPLHARWPHNFSGLFLLTVASSSLTALLLSQLVRRKLHQKTK
Source in vitro E.coli expression system
Gene Names Paqr7
Protein Names Recommended name: Membrane progestin receptor alpha Short name= mPR alpha Alternative name(s): PPAR-gamma-induced liver protein Progestin and adipoQ receptor family member VII
Expression Region 1-345
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway. May be involved in oocyte maturation. Involved in neurosteroid inhibition of apoptosis. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Tissue Specificity Detected in most adult tissues. Higher expression found in white fat and liver than brown fat and skeletal muscle.
Database Links

KEGG: mmu:71904

STRING: 10090.ENSMUSP00000080240

UniGene: Mm.142343

Related Products

Paqr7 Proteins

Paqr7 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.