Recombinant Mouse Membrane progestin receptor gamma(Paqr5)

in vitro E.coli expression system

Code	CSB-CF880575MO
Size	Pls inquire other sizes
Source	in vitro E.coli expression system

Product Details
Related Products
Target Data

Product Details

Target Names	Paqr5
Uniprot No.	Q9DCU0
Species	Mus musculus (Mouse)
Expression Region	1-330
Target Protein Sequence	MLSLKLPRLFRIDQVPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFW FFVWRFMTALYVTDIQNDSYSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDY GAVNLFSLGSAIAYSAYTFPDALVCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRL CKLLRVLAFAYPYTWDSLPIFYRLFLFPGESSRNEAMLYHQKHMGMTLLASFFYSAHLPE RLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAML LCIIFSLSNIIYFSAALYRIPEPELHEKET
Protein Length	full length protein
Tag Info	The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form	Lyophilized powder
Buffer before Lyophilization	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet	Please contact us to get it.
Still Have Questions?	Start a Chat

Target Data

Function	Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway. May be involved in oocyte maturation.
Subcellular Location	Cell membrane, Multi-pass membrane protein
Protein Families	ADIPOR family
Database Links	KEGG: mmu:74090 STRING: 10090.ENSMUSP00000034817 UniGene: Mm.273267