Recombinant Mouse Membrane progestin receptor gamma(Paqr5)

Code CSB-CF880575MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9DCU0
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MLSLKLPRLFRIDQVPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFW FFVWRFMTALYVTDIQNDSYSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDY GAVNLFSLGSAIAYSAYTFPDALVCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRL CKLLRVLAFAYPYTWDSLPIFYRLFLFPGESSRNEAMLYHQKHMGMTLLASFFYSAHLPE RLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAML LCIIFSLSNIIYFSAALYRIPEPELHEKET
Source in vitro E.coli expression system
Gene Names Paqr5
Protein Names Recommended name: Membrane progestin receptor gamma Short name= mPR gamma Alternative name(s): Progestin and adipoQ receptor family member V
Expression Region 1-330
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway. May be involved in oocyte maturation.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Database Links

KEGG: mmu:74090

STRING: 10090.ENSMUSP00000034817

UniGene: Mm.273267

Related Products

Paqr5 Proteins

Paqr5 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.