Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF880575MO |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q9DCU0 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Mus musculus (Mouse) |
| Sequence | MLSLKLPRLFRIDQVPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFW FFVWRFMTALYVTDIQNDSYSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDY GAVNLFSLGSAIAYSAYTFPDALVCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRL CKLLRVLAFAYPYTWDSLPIFYRLFLFPGESSRNEAMLYHQKHMGMTLLASFFYSAHLPE RLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAML LCIIFSLSNIIYFSAALYRIPEPELHEKET |
| Source | in vitro E.coli expression system |
| Gene Names | Paqr5 |
| Protein Names | Recommended name: Membrane progestin receptor gamma Short name= mPR gamma Alternative name(s): Progestin and adipoQ receptor family member V |
| Expression Region | 1-330 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway. May be involved in oocyte maturation. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | ADIPOR family |
| Database Links |
KEGG: mmu:74090 STRING: 10090.ENSMUSP00000034817 UniGene: Mm.273267 |
Paqr5 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP880575MO1 CSB-EP880575MO1 CSB-BP880575MO1 CSB-MP880575MO1 |
Recombinant Mouse Membrane progestin receptor gamma(Paqr5),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Bacillus subtilis Uncharacterized protein YuaB(yuaB) (Active)
Express system: in vitro E.coli expression system
Species: Bacillus subtilis (strain 168)
Recombinant Human Cyclic AMP-dependent transcription factor ATF-7(ATF7)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Lymphocyte-specific protein 1(LSP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ribonucleoside-diphosphate reductase large subunit(RRM1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Visinin-like protein 1(VSNL1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human GTP-binding nuclear protein Ran(RAN)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Annexin A8-like protein 2(ANXA8L2)
Express system: E.coli
Species: Homo sapiens (Human)
