Recombinant Mouse N-acetylaspartate synthetase (Nat8l)

Code CSB-CF663658MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Nat8l
Uniprot No.
Alternative Names
Nat8l; N-acetylaspartate synthetase; NAA synthetase; N-acetyltransferase 8-like protein; Protein Shati
Species
Mus musculus (Mouse)
Expression Region
1-299
Target Protein Sequence
MHCGPPDMVCETKIVATEDHEALPGAKKDALLVAAGAMWPPLPAAPGPAAAPPPAAGPQP HGGTGGAGPPEGRGVCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYAL LAALCFAVTRSLLLTCLVPAGLLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSC FWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKSIAKALGRRVLEFAMLHNYSA VVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the regulation of lipogenesis by producing N-acetylaspartate acid (NAA), a brain-specific metabolite. NAA occurs in high concentration in brain and its hydrolysis plays a significant part in the maintenance of intact white matter. Promotes dopamine uptake by regulating TNF-alpha expression. Attenuates methamphetamine-induced inhibition of dopamine uptake.
Gene References into Functions
  1. The findings of this study indicated that the striatal expression of N-acetylaspartate synthetase Shati/Nat8l plays a role in major depressive disorder via the metabotropic glutamate receptor 3-mediated functional control of the serotonergic neuronal system. PMID: 29020418
  2. Results showed that the Shati/Nat8L mRNA was increased by methamphetamine-induced CREB pathway via dopamine D1 receptor signaling in mouse nucleus accumbens. These findings may contribute to development of a clinical tool for methamphetamine addiction. PMID: 28319198
  3. Results showed that both Shati+/- and Shati-/- mice demonstrated lower levels of NAA in the brain than Shati+/+ mice, suggesting that SHATI predominantly regulates NAA content in the brain PMID: 26361739
  4. Study shows that Shati/Nat8l in the neuron may induce axon outgrowth by ATP synthesis and not through mGluR3 signaling. PMID: 26164607
  5. Dysregulated expression of Nat8L is associated with deficits in oxidative phosphorylation in 5xFAD model of Alzheimer disease. PMID: 25766789
  6. results indicate that Shati/Nat8l in the Nucleus Accumbens, but not in the dorsal striatum, plays a suppressive role in the behavioral responses to METHamphetamine by controlling the dopaminergic system via activation of group II mGlutamate receptors PMID: 24559655
  7. The results of this study showed that Deletion of NAT8L increases dopamine D1 receptor on the cell surface in the nucleus accumbens, accelerating methamphetamine dependence in mice. PMID: 24246274
  8. Nat8l impacts on the brown adipogenic phenotype PMID: 24155240
  9. Deficiency of SHATI may affect behavior. PMID: 22940080
  10. shati expression affects emoutional behaivors in mice PMID: 22708272
  11. Asp-NAT enzyme activity in Nat8l-transfected cells is more than 300 times that of the mock-transfected controls and shows an extraordinarily high enzymatic specificity for aspartate, with less than 1% of enzymatic activity using glutamate as substrate. PMID: 20385109
  12. Nat8l is highly specific to aspartate. It is localized in mitochondria and microsomes, with a pattern comparable to the localization of NAA in brain. It is similar to NAG synthetase in catalytic mechanism without the involvement of cysteine. PMID: 20385109
  13. Results indicated that NAT8L, but not NAT14, catalysed the synthesis of NAA from L-aspartate and acetyl-CoA. PMID: 19807691
  14. Roles of shati in methamphetamine (METH)-regulated behavioral alternations are likely to be mediated by its inhibitory effects on METH-induced increase of dopamine(DA) overflow in nucleus accumbens and METH-induced decrease in DA uptake in midbrain. PMID: 17626222

Show More

Hide All

Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Rough endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
Camello family
Tissue Specificity
Expressed in brain, kidney, liver and spleen. In brain, present in neurons but not in astrocytes (at protein level). Expressed in brain, thymus and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1