Recombinant Mouse Olfactory receptor 144(Olfr144)

Code CSB-CF335998MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P34983
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MEDMAAGNHCTVTEFFLAGLSEKPELQLPLFLLFTGIYLITMAGNLGMITLIGLSSHLHT PMYYFLSSLSFIDFCQSTVVIPKMLVSFLTEMNIISYSECMAQLYFFLTFGIAECYTLAA MAYDRYVAICNPLLYNVTMSYQIYSSLISGVYIFAVICSSFNTGFMLRTQFCNLDVINHY FCDLLPLLNLASSNTYINEILILFFATLNSFVPVLTIITSYIFIIVTILSIHSREGKFKA FSTCSTHISAVAIFYGSGAFTYLQPSSLNSMGQAKVSSVFYTTVVPMLNPLIYSLRNKDV SIALKKILERKKFM
Source in vitro E.coli expression system
Gene Names Olfr1537
Protein Names Recommended name: Olfactory receptor 144 Alternative name(s): Odorant receptor K4 Olfactory receptor 7B
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:257959

STRING: 10090.ENSMUSP00000072979

UniGene: Mm.335076

Related Products

Olfr1537 Proteins

Olfr1537 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.