Recombinant Mouse Palmitoyltransferase ZDHHC17 (Zdhhc17)

Code CSB-CF800322MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Zdhhc17
Uniprot No.
Alternative Names
Zdhhc17; Hip14; Kiaa0946; Palmitoyltransferase ZDHHC17; Acyltransferase ZDHHC17; DHHC domain-containing cysteine-rich protein 17; DHHC-17; Huntingtin-interacting protein 14; Zinc finger DHHC domain-containing protein 17
Species
Mus musculus (Mouse)
Expression Region
1-632
Target Protein Sequence
MQREEGFNTKMADGPDEYETETGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD IVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLG GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKG QDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTV ISLLLEAGGNVDAQNVKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE FRQKVMLGTPFLVIWLVGFIADLDIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL GIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQK KKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHR YFMGYLFFLLFMICWMIYGCVSYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVF HFLWVAVLLMCQLYQITCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF RCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates and is involved in a variety of cellular processes. Has no stringent fatty acid selectivity and in addition to palmitate can also transfer onto target proteins myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA. Palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HTT. Also palmitoylates neuronal protein GPM6A as well as SPRED1 and SPRED3. Could also play a role in axonogenesis through the regulation of NTRK1 and the downstream ERK1/ERK2 signaling cascade. May be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. May play a role in Mg(2+) transport. Could also palmitoylate DNAJC5 and regulate its localization to the Golgi membrane.
Gene References into Functions
  1. These data suggest that HIP14 is essential for maintenance of life and neuronal integrity in the adult mouse. PMID: 27927242
  2. The findings of this study identify ZDHHC17 as an important upstream factor of ERK1/2 to regulate the interaction between TrkA and tubulin during neuronal development. PMID: 26232532
  3. In the absence of HIP14, striatal neurons become dysfunctional, leading to impaired motor behavior. PMID: 24376823
  4. The constitutive absence of Hip14/DHHC17 results in major neurophysiological deficits and associated cognitive dysfunction. PMID: 24277827
  5. altered palmitoylation mediated by HIP14 may contribute to HD. PMID: 21775500
  6. Wild-type HTT modulates the enzymatic activity of the neuronal palmitoyl transferase HIP14. PMID: 21636527
  7. Immunohistochemical analysis of pancreatic sections demonstrated that HIP14 is almost exclusively expressed in insulin-positive cells in islets of Langerhans. PMID: 21705657
  8. Downregulation of HIP14 in mouse neurons expressing wild-type and mutant htt increases inclusion formation, whereas overexpression of HIP14 substantially reduces inclusions PMID: 16699508

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein.
Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Tissue Specificity
Expressed in liver, testis, kidney, heart, pancreas and brain. Highest expression was seen in the brain. Localized predominantly in the perinuclear regions of neurons from the cortex, striatum and hippocampus. Colocalized with HTT in the medium spiny neur
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1