Recombinant Mouse Pannexin-2 (Panx2)

Code CSB-CF746924MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Panx2
Uniprot No.
Alternative Names
Panx2; Pannexin-2
Species
Mus musculus (Mouse)
Expression Region
1-677
Target Protein Sequence
MHHLLEQSADMATALLAGEKLRELILPGSQDDKAGALAALLLQLKLELPFDRVVTIGTVL VPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDALPGVDASLWPSLFE HKFLPYALLAFAAIMYVPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQI QSKGPGITEREKREIIENAEKEKSPEQNLFEKYLERRGRSNFLAKLYLARHVLILLLSVV PISYLCTYYATQKQNEFTCALGASPDGPVGSAGPTVRVSCKLPSVQLQRIIAGVDIVLLC FMNLIILVNLIHLFIFRKSNFIFDKLNKVGIKTRRQWRRSQFCDINILAMFCNENRDHIK SLNRLDFITNESDLMYDNVVRQLLAALAQSNHDTTPTVRDSGIQTVDPSINPAEPDGSAE PPVVKRPRKKMKWIPTSNPLPQPFKEQLAIMRVENSKTEKPKPVRRKTATDTLIAPLLDA GARAAHHYKGSGGDSGPSSAPPAASEKKHTRHFSLDVHPYILGTKKAKTEAVPPALPASR SQEGGFLSQTEECGLGLAAAPTKDAPLPEKEIPYPTEPALPGLPSGGSFHVCSPPAAPAA ASLSPGSLGKADPLTILSRNATHPLLHISTLYEAREEEEGGPCAPSDMGDLLSIPPPQQI LIATFEEPRTVVSTVEF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Structural component of the gap junctions and the hemichannels.
Gene References into Functions
  1. Panx2 is an important regulator of the insulin secretory capacity and apoptosis in pancreatic beta-cells. PMID: 28390953
  2. It used overlap-extension cloning to create the first chimeric Panx, consisting of Panx2 with the Panx1 C-terminus (Panx2(Panx1CT)), to determine whether the Panx1 C-terminus influences the trafficking of Panx2. PMID: 23659289
  3. ). Pannexin double-knockout mice (Px1(-/-) Px2(-/-)) were less impaired in parameters such as exploration, anxiety, sensorimotor function and behavioral symmetry. PMID: 23111424
  4. In situ hybridization revealed that mRNAs for Panx1 and Panx2 were both expressed in the olfactory epithelium and olfactory bulb. PMID: 22945868
  5. Px1 and Px2 underlie channel function in neurons and contribute to ischemic brain damage PMID: 22147915
  6. Pannexin 2 is expressed by postnatal hippocampal neural progenitors and modulates neuronal commitment PMID: 20529862
  7. Panx2 strongly interacts with the core and high-mannose species of Panx1 but not with Panx3. The combination of Panx1 & Panx2 results in compromised channel function. PMID: 19692571
  8. Results reveal a widespread and similar mRNA distribution for both pannexin 1 and 2, but indicate that they are inversely regulated during the development of the rat brain. PMID: 16143426
  9. Panx1 and Panx2 are abundantly expressed in the retina, and may therefore contribute to the electrical and metabolic coupling, or to signaling between retinal neurons PMID: 16616526
  10. Despite similarity in detergent solubility of pannexins and connexins, the lack of spatial co-localization in the lens membranes suggested a distinct, non-redundant to connexin function for these proteins in the lens cell membrane. PMID: 17149368
  11. Data show that Panx2 is expressed in the spiral and Scarpa's ganglion neurons. PMID: 18695503

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Pannexin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1