Recombinant Mouse Polypeptide N-acetylgalactosaminyltransferase 1(Galnt1)

Code CSB-CF009203MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O08912
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MRKFAYCKVVLATSLVWVLLDMFLLLYFSECNKCEEKQERGLPAGDVLELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNVTLPEIF
Source in vitro E.coli expression system
Gene Names Galnt1
Protein Names Recommended name: Polypeptide N-acetylgalactosaminyltransferase 1 EC= 2.4.1.41 Alternative name(s): Polypeptide GalNAc transferase 1 Short name= GalNAc-T1 Short name= pp-GaNTase 1 Protein-UDP acetylgalactosaminyltransferase 1 UDP-GalNAc:p
Expression Region 1-559
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.
Subcellular Location Polypeptide N-acetylgalactosaminyltransferase 1: Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Polypeptide N-acetylgalactosaminyltransferase 1 soluble form: Secreted
Protein Families Glycosyltransferase 2 family, GalNAc-T subfamily
Tissue Specificity Widely expressed at high level. Higher expression in kidney, heart, small intestine and cervix and to a lesser extent in all the other tissues tested.
Database Links

KEGG: mmu:14423

STRING: 10090.ENSMUSP00000000430

UniGene: Mm.30249

Related Products

Galnt1 Proteins

Galnt1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.