Recombinant Mouse Potassium channel subfamily K member 4(Kcnk4)

Code CSB-CF012072MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O88454
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MRSTTLLALLALVLLYLVSGALVFQALEQPHEQQAQKKMDHGRDQFLRDHPCVSQKSLED FIKLLVEALGGGANPETSWTNSSNHSSAWNLGSAFFFSGTIITTIGYGNIVLHTDAGRLF CIFYALVGIPLFGMLLAGVGDRLGSSLRRGIGHIEAIFLKWHVPPGLVRSLSAVLFLLIG CLLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGDYVPGDGTGQNSPAYQPLVWFWI LFGLAYFASVLTTIGNWLRAVSRRTRAEMGGLTAQAASWTGTVTARVTQRTGPSAPPPEK EQPLLPSSLPAPPAVVEPAGRPGSPAPAEKVETPSPPTASALDYPSENLAFIDESSDTQS ERGCALPRAPRGRRRPNPSKKPSRPRGPGRLRDKAVPV
Source in vitro E.coli expression system
Gene Names Kcnk4
Protein Names Recommended name: Potassium channel subfamily K member 4 Alternative name(s): TWIK-related arachidonic acid-stimulated potassium channel protein Short name= TRAAK
Expression Region 1-398
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Voltage-insensitive potassium channel
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Expressed in brain, spinal cord and eye. Not detected in heart, skeletal muscle, liver, lungs, kidney and testis.
Database Links

KEGG: mmu:16528

STRING: 10090.ENSMUSP00000025908

UniGene: Mm.12894

Related Products

Kcnk4 Proteins

Kcnk4 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.