Recombinant Mouse Putative small membrane protein NID67(Nid67)

Code CSB-CF858171MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99PE5
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA
Source in vitro E.coli expression system
Gene Names Smim3
Protein Names Recommended name: Putative small membrane protein NID67 Alternative name(s): NGF-induced differentiation clone 67 protein
Expression Region 1-60
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

KEGG: mmu:106878

STRING: 10090.ENSMUSP00000039285

UniGene: Mm.273197

Related Products

Smim3 Proteins

Smim3 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.