Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 11(Skint11)

Code CSB-CF415983MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7XV14
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence LDIQINTQIPDTEEGVLVECTAESLFPPAEMTWRDSKGNIIPPSSTFDSQDRAGLLCLKS TILLKNRTEGPITCSIYNKTTNQEKRRSIILSDVLFRPQYMSLMSNNLLYLGIYLIFILF LNFLKGILFCLTKRLVHFRKRMIKIKKVWSNKTRACCPLIWEFLEIVLFIAFLPLYLMFR IRVFTLDEAHILYNNWLWKVCKTLIAMMILFTVLILFLLWTLNRYGKMPCLSSMNIDVST HDAEQNSSKSAKFQENYDVAGQMILETYEETIFCQHQESCEEYNYDPLLLSSLDALGTCE DEKFSQHQESFEEDEDLQSFSDFKIELYSKLGNLTH
Source in vitro E.coli expression system
Gene Names Skint11
Protein Names Recommended name: Selection and upkeep of intraepithelial T-cells protein 11 Short name= Skint-11
Expression Region 29-364
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act by engaging a cell surface molecule on immature T-cells in the embryonic thymus.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families SKINT family
Tissue Specificity Expressed in skin and thymus.
Database Links

KEGG: mmu:230623

UniGene: Mm.124482

Related Products

Skint11 Proteins

Skint11 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.