Recombinant Mouse Transmembrane protein 236(Tmem236)

Code CSB-CF008186MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A2ARJ3
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MASGKIIKLVVFELLEFAAFSIPTLVIMEQFATANQRTKSERTHYWLIVSCSIAYVAVVS LLIWVPVKVVLYKKRHLYKKIIGWRPVLVMCVVLTTLPSFSFSIAVTEVQKNINGSANSL PESLPDLPVSLVLLSLIVVDIIEKLRQYPLRGSQKGYEDNDICITSLQQIKTVTEQVVQS DGNPASAQAAKPTAMSQPRNHVAVLAGPLEPSFQSRILRTMSQRDVRAELFLRSFLMWAD TVEMLRVAGHQAVYKSAWLYPVYIFSFISLLRMVFTPKNPLLNSLGILMQDLPFVFLRLS LILALGTITPVLGLCKNVLVTISYIYFNYVTKLRPFSAFETSPF
Source in vitro E.coli expression system
Gene Names Tmem236
Protein Names Recommended name: Transmembrane protein 236
Expression Region 1-344
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TMEM236 family
Database Links

KEGG: mmu:625286

STRING: 10090.ENSMUSP00000076722

UniGene: Mm.158781

Related Products

Tmem236 Proteins

Tmem236 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.