Recombinant Neurospora crassa Solute carrier family 25 member 38 homolog(B7F18.090, NCU02973)

Code CSB-CF836308NHA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96U08
Storage Buffer Tris-based buffer,50% glycerol
Species Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Sequence MSDGSRKSGTKSTFHFVAGLGSGVLSAILLQPIDLLKTRVQQSGKHSLRAALAELRSSQQ GLLPSLWRGTLPSALRTGFGSAIYFTTLNTIRENAARHLPSLAAAAPTIAAASGIVAPNA NQTSSSLPKLSNTGNLLAGAVARSFAGFILMPLTVLKVRYESSFYKYTSLAGAARDIART EGARGFFAGFGATAIRDAPYAGLYVLFYEKSKQHLSNLFPQPPQPQLSTTTTLEAAAGQD GGGRMSQSRAASINFASGVFSAIICSIISNPFDAVKTRIQLQPKKYRNMVQASRKMLAEE GVRSMMDGLALRMSRKAMSSALAWTVYEELIRRAEGAWTKRGPEEVQL
Source in vitro E.coli expression system
Gene Names mic-13
Protein Names Recommended name: Solute carrier family 25 member 38 homolog
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mitochondrial carrier required for the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane.
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Database Links

KEGG: ncr:NCU02973

Related Products

mic-13 Proteins

mic-13 Proteins for Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.