Recombinant Nocardia farcinica UPF0353 protein NFA_34780(NFA_34780)

Code CSB-CF736508NAAA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5YU15
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Nocardia farcinica (strain IFM 10152)
Sequence MSISHFTALIWLGFLAVVALIALGYVLVQRSRHRQMLRFSNMEVLEKVAPSRPSPLRHAP IALMLVGLVFLTIAAAGPTSVQKVPRNRATVVLVMDVSLSMEATDVPPSRLEVAQQAGKE FVDGLTQGINLGFVTFAGTASVMQSPTTNREAVKAAIDNIKLAERTATGEGILTALQSIE TLATVLGGAETPPPARIVLMSDGKQTVPDDKDVDNPRHAFTAARLAKSKGIPVSTISFGT EWGSVEIPDQDGQGGSQRVKVPVDNESLREIAKLSGGEFYTASSLEELTAVYDTLEEQIG YETTRGDASRPWLLLGMLVVAAGIVTGLLYRQRLP
Source in vitro E.coli expression system
Gene Names NFA_34780
Protein Names Recommended name: UPF0353 protein NFA_34780
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0353 family
Database Links

KEGG: nfa:NFA_34780

STRING: 247156.nfa34780

Related Products

NFA_34780 Proteins

NFA_34780 Proteins for Nocardia farcinica (strain IFM 10152)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.