Recombinant Nocardia farcinica UPF0353 protein NFA_34780(NFA_34780)

Code CSB-CF736508NAAA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5YU15
Storage Buffer Tris-based buffer,50% glycerol
Species Nocardia farcinica (strain IFM 10152)
Sequence MSISHFTALIWLGFLAVVALIALGYVLVQRSRHRQMLRFSNMEVLEKVAPSRPSPLRHAP IALMLVGLVFLTIAAAGPTSVQKVPRNRATVVLVMDVSLSMEATDVPPSRLEVAQQAGKE FVDGLTQGINLGFVTFAGTASVMQSPTTNREAVKAAIDNIKLAERTATGEGILTALQSIE TLATVLGGAETPPPARIVLMSDGKQTVPDDKDVDNPRHAFTAARLAKSKGIPVSTISFGT EWGSVEIPDQDGQGGSQRVKVPVDNESLREIAKLSGGEFYTASSLEELTAVYDTLEEQIG YETTRGDASRPWLLLGMLVVAAGIVTGLLYRQRLP
Source in vitro E.coli expression system
Gene Names NFA_34780
Protein Names Recommended name: UPF0353 protein NFA_34780
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0353 family
Database Links

KEGG: nfa:NFA_34780

STRING: 247156.nfa34780

Related Products

NFA_34780 Proteins

NFA_34780 Proteins for Nocardia farcinica (strain IFM 10152)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.