Recombinant Ostreid herpesvirus 1 Putative transmembrane protein ORF57(ORF57)

Code CSB-CF764857OBAD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6R7G8
Storage Buffer Tris-based buffer,50% glycerol
Species Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)
Sequence MTDAVKKIAKLVVDLHGEKNTQNIIEVAKAGGKESAEAVLFKKLTDAIIKDMTAMINHGD SKEKMQFTSTEQDLPMAEDTTLTNNKLFWFSVVVGIVLFVTAINYLLDKVCWIKAARKIA ITCFLISVCWNYINIYEKTMAKRYMVIRQGIPGGCMERGADWSTVLRTMFKTLMITHSDS NDECLQYAKSIIVEPLFEVTPTTALATTISDLILVPINLAAKSCNNVFRTVFEGVPVFMI PILVFLLVYISTLCIISTKRYTISVPFLLELKPCLVEPPPMVPISVRNETCNVVHKKPVA LRRGLCYNKLFRNKKY
Source in vitro E.coli expression system
Gene Names ORF57
Protein Names Recommended name: Putative transmembrane protein ORF57
Expression Region 1-316
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Host membrane, Multi-pass membrane protein
Database Links

KEGG: vg:2948171

Related Products

ORF57 Proteins

ORF57 Proteins for Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.