Recombinant Pasteurella multocida Uncharacterized protein PM0402(PM0402)

Code CSB-CF863387ESG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9CNM5
Storage Buffer Tris-based buffer,50% glycerol
Species Pasteurella multocida (strain Pm70)
Sequence MESRIVLDSRETSLLNTHKVLRNTYFLLGLTLAFSAVVAYISMSLNLPRPGLILMLAGFY GLLFLTYKLSNSGLGILSTFAFTGFLGYTLGPILNVYVSHGAGDIVVLALAGTAAVFFAC SAYVLTTKKDMSFLSGTIFALFIVLLLGMVASFFFQSPMLYIAISGLFVVFSTLGILYET SNIIHGGETNYIRATVSIFVSLYNLFISLLNIFSILSNED
Source in vitro E.coli expression system
Gene Names PM0402
Protein Names Recommended name: Uncharacterized protein PM0402
Expression Region 1-220
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families BI1 family
Database Links

KEGG: pmu:PM0402

STRING: 272843.PM0402

Related Products

PM0402 Proteins

PM0402 Proteins for Pasteurella multocida (strain Pm70)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.