Recombinant Phosphate transport system permease protein pstC(pstC)

Code CSB-CF703466MVN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q50098
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mycobacterium leprae (strain TN)
Sequence MIKPTPAAVGSYVTRRCDRLFKSAAAAAGSTVVAAILLIAIFLLLRAVPSLRANHANFFT SAKFDTTGDKNLAFGIRDLFMVTVLSSICALVLAVPVAIGIAVFLTQYVPARLSRLFSAM VDLLAAVPSIIFGLWGVFVLAPKLQPIAVFLNHNLGWLFLFKQGNVSLAGGGTIFTSGIV LAVMILPIVTSVSREVFRHTPLIQIEAAQALGATKWEVVQMTVLPFGRSGVAAAAMLGLG RALGETLAVLIILRSAARSGNWSLFDGGYTFASKIASAASEFSQPLPTGAYIAAGFALFF LTFVVNAVARAISGGRVNG
Source in vitro E.coli expression system
Gene Names pstC
Protein Names Recommended name: Phosphate transport system permease protein pstC
Expression Region 1-319
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a binding-protein-dependent transport system for phosphate; probably responsible for the translocation of the substrate across the membrane.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family, CysTW subfamily
Database Links

KEGG: mle:ML2094

STRING: 272631.ML2094

Related Products

pstC Proteins

pstC Proteins for Mycobacterium leprae (strain TN)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.