Recombinant Pongo abelii Epithelial membrane protein 1(EMP1)

Code CSB-CF007648PYX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5RCY3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Sequence MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Source in vitro E.coli expression system
Gene Names EMP1
Protein Names Recommended name: Epithelial membrane protein 1 Short name= EMP-1
Expression Region 1-157
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families PMP-22/EMP/MP20 family
Database Links

UniGene: Pab.13920

Related Products

EMP1 Proteins

EMP1 Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.