Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_1070325 (POPTRDRAFT_1070325)

Code CSB-CF497152EXS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B9GHX8
Storage Buffer Tris-based buffer,50% glycerol
Species Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Sequence MEKKDEGNPPMAVMGSRDENEDVKSTMRTAETMLRLVPVALCVSALVVMLKNTQTNDYGS LSYSDLGAFRYLVNANGICAGYSLLSAVIVAMPRAWTMPQAWTFFLLDQVLTYVILAAGT VSTEVLYLANKGDTSIAWSAACVSFGGFCHKALISTVITFVAVIFYAALSLVSSYKLFSK YDAPVVTQSGEGIKTVTLGSPPPPPPPPPSNLHLHLHAKLACPAHNNSPN
Source in vitro E.coli expression system
Gene Names POPTRDRAFT_1070325
Protein Names Recommended name: CASP-like protein POPTRDRAFT_1070325
Expression Region 1-230
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

KEGG: pop:POPTR_0001s42730g

Related Products

POPTRDRAFT_1070325 Proteins

POPTRDRAFT_1070325 Proteins for Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.