Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF495731EXS |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | B9HMP5 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Sequence | MASTDKPDRESIKSEEAPAAHPRRSNYSSVHVALRFLLFAASVTAVVVMVTAKQTKIVPV PGFPISVPLEAKFSDSPAFIYFISALSVAGLYGILTTLAAISIVLKPAYATRFLLHFALL DVLMLGIVASATGAAGGVAYVGLKGNSHVRWGKVCNVYDKFCQHVGSSIAVALFASVLLV LLTMLSVFSIYRKIPK |
| Source | in vitro E.coli expression system |
| Gene Names | POPTRDRAFT_820933 |
| Protein Names | Recommended name: CASP-like protein POPTRDRAFT_820933 |
| Expression Region | 1-196 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Casparian strip membrane proteins (CASP) family |
| Database Links |
KEGG: pop:POPTR_0008s20950g STRING: 3694.POPTR_0008s20950.1 |
POPTRDRAFT_820933 Proteins for Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP495731EXS1 CSB-EP495731EXS1 CSB-BP495731EXS1 CSB-MP495731EXS1 |
Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_820933 (POPTRDRAFT_820933),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human F-box/LRR-repeat protein 2(FBXL2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha(IL1A)
Express system: E.coli
Species: Macaca mulatta (Rhesus macaque)
Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human YEATS domain-containing protein 4(YEATS4)
Express system: E.coli
Species: Homo sapiens (Human)
