Recombinant Potato virus X Movement protein TGBp3 (ORF4)

Code CSB-CF300142PRD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P68832
Storage Buffer Tris-based buffer,50% glycerol
Species Potato virus X (strain CP) (PVX)
Sequence MEAGAYLNAIIFVLVATIIAVISRGLTRTEPCTIRITGESITVHACHIDSETIKALANLKPLSLERLSFQ
Source in vitro E.coli expression system
Gene Names ORF4
Protein Names Recommended name: Movement protein TGBp3 Alternative name(s): 7 kDa protein Triple gene block 3 protein Short name= TGBp3
Expression Region 1-70
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role in viral cell-to-cell propagation, by facilitating genome transport to neighboring plant cells through plasmosdesmata. May induce the formation of granular vesicles derived from the Endoplasmic reticulum, which align on actin filaments (By similarity).
Subcellular Location Host endoplasmic reticulum membrane
Protein Families Tymovirales TGBp3 protein family

Related Products

ORF4 Proteins

ORF4 Proteins for Potato virus X (strain CP) (PVX)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.