Recombinant Proteus mirabilis UPF0114 protein PMI3225 (PMI3225)

Code CSB-CF459580EYZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B4F181
Storage Buffer Tris-based buffer,50% glycerol
Species Proteus mirabilis (strain HI4320)
Sequence MNRIVEKWMYRSRWLFAPVYIGLSLGLLALTIKFFQSMYEILPNIFALSEADLVLRLLSL IDLALVGGLLIMVIFSGYENFITNMEIEGAKDKLSWLGNMDAESLKNKVAASIVAISSIH LLGVFMDLKNIPDNKLLWYVVLHLTFVFSAFVMGYLEKISKRSKRANKANQG
Source in vitro E.coli expression system
Gene Names PMI3225
Protein Names Recommended name: UPF0114 protein PMI3225
Expression Region 1-172
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0114 family
Database Links

KEGG: pmr:PMI3225

STRING: 529507.PMI3225

Related Products

PMI3225 Proteins

PMI3225 Proteins for Proteus mirabilis (strain HI4320)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.