Recombinant Putative cytochrome c-type biogenesis protein dbsD-like

Code CSB-CF633573EXX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q1XDC3
Storage Buffer Tris-based buffer,50% glycerol
Species Pyropia yezoensis (Susabi-nori) (Porphyra yezoensis)
Sequence MKLDLFVYNSQHFVNNITLYQLNHLNSTSFSFIFLSGLFTSLSPCIISILPVCILYIAGE TQKLNPINKTKNLFLFCLGTISSFITLGILATLITKTYSQFFNGIPTISAVVIIYMGLNL LNIVHINSPKFNGLVTNNNYNFKMYLSGVGIGIAISSCSTPIFVTLLVWINSTQKIFTGL IFILIYSIGYIFPIIIGSIFSTSFLKLTESLSGIIMAPSVELCY
Source in vitro E.coli expression system
Protein Names Recommended name: Putative cytochrome c-type biogenesis protein dbsD-like
Expression Region 1-224
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Could be involved in cytochrome c synthesis.
Subcellular Location Plastid, chloroplast membrane, Multi-pass membrane protein
Protein Families DsbD family

Related Products

Proteins

Proteins for Pyropia yezoensis (Susabi-nori) (Porphyra yezoensis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.