Recombinant Putative zinc metalloprotease CPE1693(CPE1693)

Code CSB-CF838023CMB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8XJR2
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Clostridium perfringens (strain 13 / Type A)
Sequence MYIIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPF GGFVKMLGEEDESDDSRSLNAKTPIQRILVMGAGAFMNYVLALIIFIGLAMSSGFAENKV ASVVPNSPAQEIGIEQGDEFLKIDGNKIHTTDDFRMGLALAKGNPVELEIKRGNDVLTKT VQPILNESGMYQVGISYALVEKPTLLQGIKQGFNETRSLVSQSFIALKTIVTGEANLKTD VGGPVTIIKMSGQAAKAGANTLLWFMAFLSVQLAVFNLLPFPALDGGRIFIELIQMIIRK EIPAKYIEAVNTVGFMLLMGLMVLVTIKDIIFPIL
Source in vitro E.coli expression system
Gene Names CPE1693
Protein Names Recommended name: Putative zinc metalloprotease CPE1693 EC= 3.4.24.-
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: cpe:CPE1693

Related Products

CPE1693 Proteins

CPE1693 Proteins for Clostridium perfringens (strain 13 / Type A)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.