Recombinant Putative zinc metalloprotease CPE1693(CPE1693)

Code CSB-CF838023CMB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8XJR2
Storage Buffer Tris-based buffer,50% glycerol
Species Clostridium perfringens (strain 13 / Type A)
Sequence MYIIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPF GGFVKMLGEEDESDDSRSLNAKTPIQRILVMGAGAFMNYVLALIIFIGLAMSSGFAENKV ASVVPNSPAQEIGIEQGDEFLKIDGNKIHTTDDFRMGLALAKGNPVELEIKRGNDVLTKT VQPILNESGMYQVGISYALVEKPTLLQGIKQGFNETRSLVSQSFIALKTIVTGEANLKTD VGGPVTIIKMSGQAAKAGANTLLWFMAFLSVQLAVFNLLPFPALDGGRIFIELIQMIIRK EIPAKYIEAVNTVGFMLLMGLMVLVTIKDIIFPIL
Source in vitro E.coli expression system
Gene Names CPE1693
Protein Names Recommended name: Putative zinc metalloprotease CPE1693 EC= 3.4.24.-
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: cpe:CPE1693

Related Products

CPE1693 Proteins

CPE1693 Proteins for Clostridium perfringens (strain 13 / Type A)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.