Recombinant Pyrococcus abyssi Molybdate/tungstate transport system permease protein wtpB(wtpB)

Code CSB-CF892666FHV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9V2C1
Storage Buffer Tris-based buffer,50% glycerol
Species Pyrococcus abyssi (strain GE5 / Orsay)
Sequence MGGRDYTLYLFAALGSFLIVYIALPIIVIFTKQALDFRMLVKTIHDPLVIEALRNSLLTA TATALISLLFGVPLGYVLARKDFRGKSLVQAIIDVPIVIPHSVVGIMLLVTFSNAILDSY KGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASKLRTFFSISLPIALPSIASG AIMAWARGISEVGAILIVAYYPKTAQVLVMEYFNNYGLRASRPISVILMGISLGIFVVLR WLIGKAKS
Source in vitro E.coli expression system
Gene Names wtpB
Protein Names Recommended name: Molybdate/tungstate transport system permease protein wtpB
Expression Region 1-248
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the ABC transporter complex WtpABC involved in molybdate/tungstate import. Probably responsible for the translocation of the substrate across the membrane (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family
Database Links

KEGG: pab:PAB0102

STRING: 272844.PAB0102

Related Products

wtpB Proteins

wtpB Proteins for Pyrococcus abyssi (strain GE5 / Orsay)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.