Recombinant Pyrococcus horikoshii UPF0252 protein PH1321 (PH1321)

Code CSB-CF524540FHX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O59045
Storage Buffer Tris-based buffer,50% glycerol
Species Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Sequence MQEYKELIKECAKELEGLMPEISQKLVNIAKINSPDRAFLEYLKVVEQVSLMKTERKQKN KALIILWRYGEALEKELYSDVKFFAKPLHKRIFRFVDWKIIGMLFLVFIILPAITSNLWS FRSEHYVLYLNENVDFPRELCNYRTSWLYDFRTSMVCVLKYGYGSINVTLRGNSWEKGVE AQRFISDMEYDFDRVKSPITYIQTPKETLRYKKGVCSDFALLVANILLDNNVSPVYIVHT VVRKEPSGGHAAAGIYVNGTLWILDWGSKPTKFQEYLENIDRIWEIREVRIYRITRDRIT LERIYKARLEDDRWRFLYSVIIMLGIFILKRREWWIM
Source in vitro E.coli expression system
Gene Names PH1321
Protein Names Recommended name: UPF0252 protein PH1321
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families UPF0252 family
Database Links

KEGG: pho:PH1321

STRING: 70601.PH1321

Related Products

PH1321 Proteins

PH1321 Proteins for Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.