Recombinant Rabbit Potassium voltage-gated channel subfamily A member 2(KCNA2)

Code CSB-CF600966RB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q09081
Storage Buffer Tris-based buffer,50% glycerol
Species Oryctolagus cuniculus (Rabbit)
Sequence NRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPL PENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENDMHGTFHT YSNSTIGYQQTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIISIIP YLATLITELVQEDGAQRQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRE LGLLIFFLFIGVILFSSAVYFAEVDEPDSQFPS
Source in vitro E.coli expression system
Gene Names KCNA2
Protein Names Recommended name: Potassium voltage-gated channel subfamily A member 2 Alternative name(s): KC22 Voltage-gated potassium channel subunit Kv1.2
Expression Region 1-273
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane
Subcellular Location Cell membrane, Multi-pass membrane protein, Membrane, Cell projection, axon, Cell junction, synapse, Cell junction, synapse, presynaptic cell membrane, Cell junction, synapse, synaptosome, Endoplasmic reticulum membrane, Cell projection, dendrite, Cell projection, lamellipodium membrane, Cell junction, paranodal septate junction
Protein Families Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.2/KCNA2 sub-subfamily
Tissue Specificity Detected in portal vein myocytes (at protein level) (PubMed:11717160). Detected in portal vein (PubMed:11717160). Brain, liver and kidney.
Database Links

KEGG: ocu:100009479

STRING: 9986.ENSOCUP00000007687

UniGene: Ocu.2363

Related Products

KCNA2 Proteins

KCNA2 Proteins for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.