Recombinant Rabbit Zona pellucida sperm-binding protein 4(ZP4)

Code CSB-CF027122RB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q00193
Storage Buffer Tris-based buffer,50% glycerol
Species Oryctolagus cuniculus (Rabbit)
Sequence KQPKPETPTDPGVLHCRPWNFKFTINFQNQETGSSPVLVTWDNQGRLHRLQNDTDCGTRVGEGPGPSVVLEANYSSCYVTESEPYYVMLVGVEEVDAAGQNLVTKQQLLKCPMHLPAPDAGLCDSVPVQDRLPCATAPISQEDCEELGCCHSSEEVNACYYGNTVTSHCTQEGHFSIAVSRNVSSPPLHLDSVHLVFGNDSECQPVVATRAFVLFLFPFTACGTTRQITGDRAIYENELLATREVRTWSRGSITRDSIFRLRVSCSYSISSSALPVDMHVLTLPPPLPETQPGPLTVVLQIAKDKDYHSYYTMDDYPVVKLLRDPIYVDVSILYRTDPYLGLRLHQCWATPRTNPLYQPQWPILVKGCPYTGDNYQTQLIPVQEAFDLPFPSHHQRFSISTFSFLDSSVAKEALKGPIYLHCSVSVCQPTGTQSCTVTCPIDSRRRNSDINFQNSTANISSKGPMI
Source in vitro E.coli expression system
Gene Names ZP4
Protein Names Recommended name: Zona pellucida sperm-binding protein 4 Alternative name(s): RC55 Zona pellucida glycoprotein 4 Short name= Zp-4 Zona pellucida glycoprotein X Short name= Zp-X Zona pellucida protein B Cleaved into the following chain: 1
Expression Region 25-466
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP4 may act as a sperm receptor.
Subcellular Location Processed zona pellucida sperm-binding protein 4: Secreted, extracellular space, extracellular matrix
Protein Families ZP domain family, ZPB subfamily
Tissue Specificity Oocytes (at protein level).
Database Links

KEGG: ocu:100009131

STRING: 9986.ENSOCUP00000022164

UniGene: Ocu.1977

Related Products

ZP4 Proteins

ZP4 Proteins for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.