Recombinant Ralstonia solanacearum Putative zinc metalloprotease RSc1411(RSc1411)

Code CSB-CF852182RAR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8XZI4
Storage Buffer Tris-based buffer,50% glycerol
Species Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Sequence MLTVLAFVFAIAVLIVVHELGHYSVARLCGVKVLRFSVGFGKVLFRRVGRGPDRTEWTLC AIPLGGYVKMLGESARDPERDPPIPPEDLPRTFDHQPVYKRFAIVAAGPVFNFLLAIALY ALLAWVGAQEPLPILGAPPPGSIAAQADLRAKDRVVAVGTDEEAPTPVRAWSDVRMRLYE AGIGGRDAIVQVRGADGAERTVRLRELPSAARSPQVDVIEQVGLRLLGGPVTIAEVLPGS AGERAGLRRGDQIVRFAGQPADQASDLIRWIRAMPEQNASIDILRDGLPMTLPVRLGADA DSANPGGPKLGKLGAQLSQHVETELIRDEPVHALGHAMREVWRTSMLSLKVLGKMIVGQA SLQNLSGPITVADFAGKAASLGWQSFVAFLALISVSLGVLNLLPVPVLDGGHLLYYCVEF LTGKPVPESWQAVLQKIGIACILLLTSLALYNDLSRLFLAHG
Source in vitro E.coli expression system
Gene Names RSc1411
Protein Names Recommended name: Putative zinc metalloprotease RSc1411 EC= 3.4.24.-
Expression Region 1-462
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: rso:RSc1411

STRING: 267608.RSc1411

Related Products

RSc1411 Proteins

RSc1411 Proteins for Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.