Recombinant Rat Gap junction alpha-5 protein (Gja5)

Code CSB-CF009448RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Gja5
Uniprot No.
Alternative Names
Gja5; Cxn-40; Gap junction alpha-5 protein; Connexin-40; Cx40
Species
Rattus norvegicus (Rat)
Expression Region
2-356
Target Protein Sequence
GDWSFLGEFLEEVHKHSTVIGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGC QNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKQKLREAEKAKEAGGTG TYEYLAEKAELSCWKEVNGKIVLQGTLLNTYVCTILIRTAMEVAFMVGQYLLYGIFLDTL HVCRRSPCPHPVNCYVSRPTEKNVFIVFMMAVAGLSLFLSLAELYHLGWKKIRQRLAKSR QGDKHQLLGPSTSLVQGLTPPPDFNQCLKNSPDEKFFSDFSNNMGSRKNPDPLATEEVPN QEQIPEEGFIHTQYGQKPEQPSGASAGHRFPQGYHSDKRRLSKASSKARSDDLSV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
  1. The A96S, G38D, and P88S Cx40 mutations slow conduction and increased the propensity for inducible AF. PMID: 28457700
  2. Lipopolysaccharide impairs permeability of pulmonary microvascular endothelial cells via Connexin40/protein kinase C/nfkappaB pathway. PMID: 28870649
  3. This study demonstrated the Cx40 was upregulated after traumatic brain injury in a linear correlated manner with increased oxidative stress. PMID: 28157110
  4. data are consistent with contributions of G2 and D3 residues to Cx40 channel pore structure, but not with postulated hydrophobic W4 intermolecular interactions; results indicate an absolute requirement for an amphipathic W3/4 residue; alternatively hypothesize that the connexin D2/3-W3/4 locus interacts with the highly conserved FIFR M1 motif to stabilize the NT domain within the pore PMID: 27304225
  5. Data show that the ratio of peripheral blood CD4(+)/CD8(+) T lymphocytes and the levels of connexin-40 (Cx40), interleukins IL-2, IL-4 and IL-6 are significantly elevated in SH rats. PMID: 26927369
  6. Cx40 expression in mesangial cells is related to mesangial cell regeneration PMID: 22945766
  7. The expressions of Cx40 and HCN4 increase obviously after coculturing bone marrow mesenchymal stem cells with sinoatrial node tissue. PMID: 22403875
  8. Valsartan and U0126 were equivalent on attenuating atrial fibrosis and Cx40 remodeling by inhibiting ERK pathways at different levels. PMID: 22336507
  9. three-dimensional molecular topography and calcium-sensitive conformational changes of Connexin40 hemichannels PMID: 21543330
  10. The demonstrated that in the endothelium of the native vein, the gap-junctional spot numbers (GJSNs) and the total gap-junctional areas (TGJAs) of Cx40 were lower than those of the thoracic aorta. PMID: 20805582
  11. Data show heterogeneous expression of the 3 Cx isoforms Cx43, Cx45, and Cx40 in heart. PMID: 17584645
  12. The total amount of connexins and the ratio of phosphorylated/non-phosphorylated isoforms gradually increased during the re-establishment of intercellular communication in heart myocytes. PMID: 11889564
  13. Kinetics of Cx40 voltage gating. There was a temporal correlation between development of conduction delay or block and the inactivation phase of junctional conductance. PMID: 14693688
  14. role for Cx40 in EDHF-mediated dilation of rat mesenteric arteries. PMID: 16037574
  15. data suggest that the HKH motif at positions 15-17 is important to the conformational structure of the putative voltage sensor and spermine receptor of Cx40 PMID: 16284078
  16. Adrenergic stimulation of cardiomyocytes can enhance connexin expression thereby increasing cellular coupling, indicating a possible role for catecholamines in the regulation of cardiac gap junction expression in cardiac disease. PMID: 16352648
  17. Structural remodelling of gap junction connexin proteins may partly underlie electrophysiological defects in STZ-induced diabetic rat sinus atrial node. PMID: 17632690
  18. Report regulation of connexin 40 gene expression during skeletal muscle regeneration in the adult rat. PMID: 19129462
  19. the selectivities of junctions formed by cells coexpressing Cx40 and Cx43 vary considerably, reflecting both their relative expression levels and phosphorylation-dependent regulation PMID: 19465552
  20. Cx40/43 can regulate the superior mesenteric artery endothelium-dependent vascular contractive response through [Ca2+]i of vascular smooth muscle cells after hemorrhagic shock. PMID: 19588758

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Tissue Specificity
Highly expressed in lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1