Recombinant Rat Olfactory receptor-like protein I15

Code CSB-CF329391RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P23274
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MTEENQTVISQFLLLFLPIPSEHQHVFYALFLSMYLTTVLGNLIIIILIHLDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPFAGCLTQLYFYLYFADLESFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCADNMIPHFFCD ISPLLKLSCSDTHVNELVIFVMGGLVIVIPFVLIIVSYARVVASILKVPSVRGIHKIFST CGSHLSVVSLFYGTIIGLYLCPSANNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKEA LIRVLCKKKITFCL
Source in vitro E.coli expression system
Gene Names Olr1468
Protein Names Recommended name: Olfactory receptor-like protein I15
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Olfactory epithelium.
Database Links

KEGG: rno:404977

STRING: 10116.ENSRNOP00000065781

UniGene: Rn.129488

Related Products

Olr1468 Proteins

Olr1468 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.