Recombinant Rat Synaptotagmin-5(Syt5)

Code CSB-CF023041RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P47861
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MFPEPPTPGSPAPETPPDSSRIRQGAVPAWVLATILLGSGLLVFSSCFCLYRKRCRRRMGKKSQAQAQVHLQEVKELGRSYIDKVQPEIEELDPSPSMPGQQVLDKHQLGRLQYSLDYDFQTGQLLVGILQAEGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGTAVGGAGLRHWADMLANPRRPIAQWHSLRPPDRARPIPAP
Source in vitro E.coli expression system
Gene Names Syt5
Protein Names Recommended name: Synaptotagmin-5 Alternative name(s): Synaptotagmin IX Synaptotagmin V Short name= SytV
Expression Region 1-386
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Regulates the Ca(2+)-dependent secretion of norepinephrine in PC12 cells. Required for export from the endocytic recycling compartment to the cell surface.
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass membrane protein, Recycling endosome membrane, Single-pass membrane protein
Protein Families Synaptotagmin family
Tissue Specificity Expressed in kidney, adipose tissue, lung and heart, as well as at higher levels in brain.
Database Links

KEGG: rno:54309

STRING: 10116.ENSRNOP00000024547

UniGene: Rn.11030

Related Products

Syt5 Proteins

Syt5 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.