Recombinant Rat Taste receptor type 2 member 129(Tas2r129)

Code CSB-CF727781RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q67ES6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MDGIIQIISAFIVIIEIIIGWFGNGFIVLVNCMHWIKRRRISTVNQILTALAFSRIYLLL TVFTVILASVQYSNILVTRREVKVIIFHLITSNHFSMWLAACLGLFYFLKIANFSNFIFV FLKKRVNKVVSGTLLMSLVFLFLNTLLINSYIDAQIDDYRGYLLYDFTSNITVSFYRVIL VINNCIFTSIPFALSQSTFLMLIFSLWRHYKKMQQHAQRCRDTLTNAHIKVLQTMIMYVL LSAIFFLFLSMQIWRNKLMENILFIRFCETVAAVFPSGHSCVLIWGDTNLRQTFLSVLWW LKHRFTLWVPKLYCR
Source in vitro E.coli expression system
Gene Names Tas2r129
Protein Names Recommended name: Taste receptor type 2 member 129 Short name= T2R129 Alternative name(s): Taste receptor type 2 member 24 Short name= T2R24
Expression Region 1-315
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative taste receptor which may play a role in the perception of bitterness.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor T2R family
Database Links

KEGG: rno:100310881

STRING: 10116.ENSRNOP00000048668

UniGene: Rn.222413

Related Products

Tas2r129 Proteins

Tas2r129 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.