Recombinant Rat Transmembrane protein 19(Tmem19)

Code CSB-CF023779RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6P726
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MLSIPSPQVLLALFSMTDLDDSTCKKYIKMITNIVILSLIICISLAFWIMSMTASTYYGS LRPVSPWRWLFSVVVSVVISCNGFKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFL TSSKLTKWRGEMKKRLDSEYKEGGQRNWVQVFCNGGVPTELALLYMIENGPGEMPIDFAK QHTASWMCLSLLAALASSAGDTWASEVAPVLSKSSPRLITTWEKVPVGTNGGVTAVGLVS SLLGGTFVGLAYFLTQLVFVNDLDISAPQWPLIAFGGLAGLLGSIVDSFLGATMQFSGLD ESTGLVVSSPTQETKHISGKPILDNNAVNLFSSVLVALLLPTAASGFWPTV
Source in vitro E.coli expression system
Gene Names Tmem19
Protein Names Recommended name: Transmembrane protein 19
Expression Region 1-351
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TMEM19 family
Database Links

KEGG: rno:299800

STRING: 10116.ENSRNOP00000005310

UniGene: Rn.131677

Related Products

Tmem19 Proteins

Tmem19 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.