Recombinant Rat Vomeronasal type-1 receptor A13(V1ra13)

Code CSB-CF711396RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5J3M4
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MSEILLFSPQPLFSYTMNKYSRLYTNSNIRNTFFSEIGIGIAANSLLLLFHIFKFIRGQR SRLTDLPIGLLSLIHLLKLLMIAFIATDIFISWRGWDDIICKFLVYLYRSFRGLSLCTTC MLSVLQAITLSPRSSCLAKFKHKSPHHVSCAILSLSVLYMFISSHLLVSLIATPNLTTNV FMYVSESCSILPMSYLMQSMFSTLLAIRDVFLISLMVLSTCYMVALLCRHRKQTRHLQGT SLSPKASPEKKATHSILMLMSFFVLMSILDSIVSCSRTMFLYDPTSYAIQIFVSHIYATV SPFVFMSNEKHIVNFLRSLCKRVINV
Source in vitro E.coli expression system
Gene Names Vom1r94
Protein Names Recommended name: Vomeronasal type-1 receptor A13
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative pheromone receptor implicated in the regulation of social as well as reproductive behavior.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 10116.ENSRNOP00000047560

UniGene: Rn.129647

Related Products

Vom1r94 Proteins

Vom1r94 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.