Recombinant Rhomboid-like protease 2(ROM2)

Code CSB-CF718170TOV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q695T9
Storage Buffer Tris-based buffer,50% glycerol
Species Toxoplasma gondii
Sequence MANIRTLSDYASSPPRGSSALEGEVGQGGSPLPLFFPSGTQSGENVSWIQWLCPGIHLKS PIIIISFVQIAVYIASLAAGLAPNEILAPTPQTLVMFGANIPELIRVGEIWRLICPLFLH LNLFHILMNLWVQIRIGLTMEEKYGWKMLLAVYFGVGVLANMISAAVLFCGQMKAGASTA VFALIGVQLAELALIWHAIQDRNSAIISVCICLFFVFVSSFGSHMDSVGHIGGLVMGFAA GIWLNENSDIKPTWYDRARLTSQVALAAAPILSCIFIFLVPRC
Source in vitro E.coli expression system
Gene Names ROM2
Protein Names Recommended name: Rhomboid-like protease 2 EC= 3.4.21.105
Expression Region 1-283
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Serine protease involved in intramembrane proteolysis and the subsequent release of polypeptides from their membrane anchors.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family

Related Products

ROM2 Proteins

ROM2 Proteins for Toxoplasma gondii

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.