Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF718170TOV |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q695T9 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Toxoplasma gondii |
| Sequence | MANIRTLSDYASSPPRGSSALEGEVGQGGSPLPLFFPSGTQSGENVSWIQWLCPGIHLKS PIIIISFVQIAVYIASLAAGLAPNEILAPTPQTLVMFGANIPELIRVGEIWRLICPLFLH LNLFHILMNLWVQIRIGLTMEEKYGWKMLLAVYFGVGVLANMISAAVLFCGQMKAGASTA VFALIGVQLAELALIWHAIQDRNSAIISVCICLFFVFVSSFGSHMDSVGHIGGLVMGFAA GIWLNENSDIKPTWYDRARLTSQVALAAAPILSCIFIFLVPRC |
| Source | in vitro E.coli expression system |
| Gene Names | ROM2 |
| Protein Names | Recommended name: Rhomboid-like protease 2 EC= 3.4.21.105 |
| Expression Region | 1-283 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Serine protease involved in intramembrane proteolysis and the subsequent release of polypeptides from their membrane anchors. |
| Subcellular Location | Membrane, Multi-pass membrane protein |
| Protein Families | Peptidase S54 family |
ROM2 Proteins for Toxoplasma gondii
| Code | Product Name | Source |
|---|---|---|
| CSB-YP718170TOV1 CSB-EP718170TOV1 CSB-BP718170TOV1 CSB-MP718170TOV1 |
Recombinant Rhomboid-like protease 2(ROM2),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Von Hippel-Lindau disease tumor suppressor(VHL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Calmodulin-like protein 3(CALML3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Inositol-trisphosphate 3-kinase B(ITPKB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Aldehyde dehydrogenase family 1 member A3(ALDH1A3)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Biliverdin reductase A(BLVRA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Protein mago nashi homolog(MAGOH)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Superoxide dismutase [Cu-Zn](Sod1)
Express system: E.coli
Species: Mus musculus (Mouse)
