Recombinant Rickettsia conorii Uncharacterized protein RC0131(RC0131)

Code CSB-CF835818RMS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q92JD6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Sequence MFKNLLCIIIFLGINLNVYAINSSSYTTDDIIKIVIILGIVILIFSPAKFRIIVIGTMLG LSCAYFTYKYIVPIFISLLNGP
Source in vitro E.coli expression system
Gene Names RC0131
Protein Names Recommended name: Uncharacterized protein RC0131
Expression Region 1-82
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: rco:RC0131

Related Products

RC0131 Proteins

RC0131 Proteins for Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.