Recombinant Salmo salar Transmembrane protein 85(tmem85)

Code CSB-CF023887SWI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B5XB24
Storage Buffer Tris-based buffer,50% glycerol
Species Salmo salar (Atlantic salmon)
Sequence MASPGGQGGGAVSTRGAGARRMKWALELSLGNARGRGDRQSNQGDVMYPIGYSDKPVPDT SIQETDKNLVEKRCWDVALGPLKQIPMNLFIMYMSGNTISIFPIMMVCMMAWRPIQALMS MSATFKLLENSNQQWLQGLVYSVGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRME IMGGGMVL
Source in vitro E.coli expression system
Gene Names emc4
Protein Names Recommended name: Transmembrane protein 85
Expression Region 1-188
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May mediate anti-apoptotic activity.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families EMC4 family
Database Links

KEGG: sasa:100196067

UniGene: Ssa.7952

Related Products

emc4 Proteins

emc4 Proteins for Salmo salar (Atlantic salmon)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.