Recombinant Spodoptera frugiperda ascovirus 1a Uncharacterized protein ORF43(ORF43)

Code CSB-CF612317SBAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q0E558
Storage Buffer Tris-based buffer,50% glycerol
Species Spodoptera frugiperda ascovirus 1a (SfAV-1a)
Sequence MSHTERIGQTPKAYVLANERGPFSVEVYLNPGTSNTYQYVATTRSKFNATDYDDLPWNYT SGKKVITANGVVSGGDRYVFALRSEIPQDIQVTMYNVNNGVSSNMNVRQPSDNSYYQPPP PPPPPRLVYNNGELYDNMINDTGYATELGKKLNDNFKKLWDYVNQPIVWLGVSALVGYLI YRYYYMSRPIGFGNSGAYDVPLLDTPLLRDSYRLPQSFTRDPIFRNSI
Source in vitro E.coli expression system
Gene Names ORF43
Protein Names Recommended name: Uncharacterized protein ORF43
Expression Region 1-228
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families Ascovirus HvAv ORF58 family
Database Links

KEGG: vg:4306164

Related Products

ORF43 Proteins

ORF43 Proteins for Spodoptera frugiperda ascovirus 1a (SfAV-1a)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.