Recombinant Triticum aestivum Probable phytol kinase, chloroplastic

Code CSB-CF643599TQN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2N2K3
Storage Buffer Tris-based buffer,50% glycerol
Species Triticum aestivum (Wheat)
Sequence AAAGVPAVAGALAASASTPAASMLLRDGGATLLVTAGAYSLVRAFDALTERRLVQQSLSR KVVHVLSGVFFMASWPLFSNSTSARFFAAVVPFLNCVRLLTYGLGFYSDEALVKSVTREG KREELLRGPLYYVIVLLIIVLVFWRDSPIGIVSLSMMSGGDGFADIVGRRFGSLKLPFNK KKSWVGSAAMFISGFLLSALMLSYFSWLGYIHVSWDQALGKLVLVALAATVVECIPVTDV VDDNISVPLATMLVAFLLFGNTAN
Source in vitro E.coli expression system
Protein Names Recommended name: Probable phytol kinase, chloroplastic EC= 2.7.-.-
Expression Region 37-300
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytol monophosphate (PMP) (By similarity).
Subcellular Location Plastid, chloroplast membrane, Multi-pass membrane protein
Protein Families Polyprenol kinase family
Database Links

UniGene: Ta.47053

Related Products

Proteins

Proteins for Triticum aestivum (Wheat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.