Recombinant UPF0353 protein MAP_1207(MAP_1207)

Code CSB-CF748226MLA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q740Y5
Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Sequence MSLPFLGPMSLSGFEHSWFFLFLLVVAGLAALYILMQLARQRRMLRFANMELLESVAPKR PSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATDVAPNRMA AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEGI FTALQAIATVGAVIGGGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAASLQELKSVYATLQQQIGY ETIKGDASVGWVRLGALVLALAALTALLINRRLPT
Source in vitro E.coli expression system
Gene Names MAP_1207
Protein Names Recommended name: UPF0353 protein MAP_1207
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0353 family
Database Links

KEGG: mpa:MAP_1207

STRING: 262316.MAP1207

Related Products

MAP_1207 Proteins

MAP_1207 Proteins for Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.