Recombinant UPF0353 protein MAP_1207(MAP_1207)

Code CSB-CF748226MLA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q740Y5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Sequence MSLPFLGPMSLSGFEHSWFFLFLLVVAGLAALYILMQLARQRRMLRFANMELLESVAPKR PSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATDVAPNRMA AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEGI FTALQAIATVGAVIGGGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAASLQELKSVYATLQQQIGY ETIKGDASVGWVRLGALVLALAALTALLINRRLPT
Source in vitro E.coli expression system
Gene Names MAP_1207
Protein Names Recommended name: UPF0353 protein MAP_1207
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0353 family
Database Links

KEGG: mpa:MAP_1207

STRING: 262316.MAP1207

Related Products

MAP_1207 Proteins

MAP_1207 Proteins for Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.