Recombinant UPF0394 membrane protein XF_0766(XF_0766)

Code CSB-CF868525XBL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9PFB2
Storage Buffer Tris-based buffer,50% glycerol
Species Xylella fastidiosa (strain 9a5c)
Sequence MSEYWYPILGGILLGLSTVMLLLLNGRIAGISGIVGRLLQGGNPAQDIPFVVGLVLGPLV FSVIFDRFPSVTVAATWPTIIVAGLLVGLGTRMSAGCTSGHGIAGIARHSPRSIVATAIF LISGMATATFMGVYQ
Source in vitro E.coli expression system
Gene Names XF_0766
Protein Names Recommended name: UPF0394 membrane protein XF_0766
Expression Region 1-135
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0394 family
Database Links

KEGG: xfa:XF_0766

STRING: 160492.XF0766

Related Products

XF_0766 Proteins

XF_0766 Proteins for Xylella fastidiosa (strain 9a5c)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.