Recombinant UPF0397 protein PA0141 (PA0141)

Code CSB-CF543498EVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B1V944
Storage Buffer Tris-based buffer,50% glycerol
Species Phytoplasma australiense
Sequence MKKNTSIKQTVTIAINTAIYVILSCFASIPIGPNVVLETSFSFLVFVAVLFGSKVGLSVG LLGHIIKDFFLFGNVYFNWIVCSGLLGFLFGLSKNLINLKYHSFTRKKILFFWLYQVFVN VLVFGLIAPISDVWIYAQPLKLVFLQGFLVVLSNILSYSLFGIFLMSKYSNNYGKKEVLA SNNCVYYKKPPLF
Source in vitro E.coli expression system
Gene Names PA0141
Protein Names Recommended name: UPF0397 protein PA0141
Expression Region 1-193
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0397 family
Database Links

KEGG: pal:PA0141

STRING: 59748.PAa_0141

Related Products

PA0141 Proteins

PA0141 Proteins for Phytoplasma australiense

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.