Recombinant Uncharacterized protein Mb2101c (Mb2101c)

Code CSB-CF353223MVH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P64932
Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Sequence MVVCLIGGVAGSLWPRPAGRLRGGCYFAFMGVAWVLLAISAIANAVKGSLWWDIWSLGLL VLIPAVVYGKMRRSRRISSDQDR
Source in vitro E.coli expression system
Gene Names BQ2027_MB2101C
Protein Names Recommended name: Uncharacterized protein Mb2101c
Expression Region 1-83
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein

Related Products

BQ2027_MB2101C Proteins

BQ2027_MB2101C Proteins for Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.