Recombinant Ustilago maydis Pheromone receptor 2(PRA2)

Code CSB-CF335620UBB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P31303
Storage Buffer Tris-based buffer,50% glycerol
Species Ustilago maydis (Corn smut fungus)
Sequence MFSGKENVSFGVLCLLAGCISTSSCLIHLQAKNIGVLLMMFWCFTGLVNKGINALAFNNS LRLAWTLGCDLSAIIERTWQFGLCCSALCVLQRLEGIASLRQAHSTVWDRKRRLLIDFGV GLGLPALQIPMFFIVQPYRLNVIENIGCSAPLYASVPALFIYHLWRLLVSLVCAVYAVLV LRWFMLRRRQFTAALSSQHSGLSQKKYFRLFALAICERVLVSAGQFYVIIQSLQIGGLLP YTSWAEVHTNFNRILFVPVDTIAHSSLLSLSILRWFSLTPAMALFVFFGLTEEAQSVYKA RWKALINLCSSKGKKQTDGRESLDLEAFESHGSKFSVLVQRDTVIC
Source in vitro E.coli expression system
Gene Names PRA2
Protein Names Recommended name: Pheromone receptor 2
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the A1 pheromone, a prenylated mating factor.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 4 family

Related Products

PRA2 Proteins

PRA2 Proteins for Ustilago maydis (Corn smut fungus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.